SCOPe 2.05: Domain d2qard_: 2qar D:

Lineage for d2qard_ (2qar D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.1: Pointed domain [47770] (7 proteins)

6. Protein Etv6 transcription factor pointed domain (Tel SAM) [74735] (2 species)

7. Species Escherichia coli [TaxId:562] [158525] (3 PDB entries)

8. Domain d2qard_: 2qar D: [167499]
   Other proteins in same PDB: d2qarc_, d2qarf_
   automated match to d1ji7c_
   complexed with nh4, no3

Details for d2qard_

PDB Entry: 2qar, 2.4 Å

PDB Description: structure of the 2tel crystallization module fused to t4 lysozyme with a helical linker.

PDB Compounds: (D:) E80-TELSAM domain

SCOPe Domain Sequences for d2qard_:

Sequence; same for both SEQRES and ATOM records:

>d2qard_ a.60.1.1 (D:) Etv6 transcription factor pointed domain (Tel SAM) {Escherichia coli [TaxId: 562]}
asirlpahlrlqpiywsrddvaqwlkwaenefslspidsntfemngkalllltkedfryr
sphsgdelyellqhilkqrpgggg

Timeline for d2qard_:

• d2qard_ first appeared in SCOPe 2.01
  
• d2qard_ appears in SCOPe 2.04
  
• d2qard_ appears in SCOPe 2.06
  
• d2qard_ appears in the current release, SCOPe 2.08