| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
| Family a.60.1.1: Pointed domain [47770] (7 proteins) |
| Protein Etv6 transcription factor pointed domain (Tel SAM) [74735] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [74736] (2 PDB entries) |
| Domain d1ji7c_: 1ji7 C: [71684] complexed with so4 |
PDB Entry: 1ji7 (more details), 1.45 Å
SCOPe Domain Sequences for d1ji7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ji7c_ a.60.1.1 (C:) Etv6 transcription factor pointed domain (Tel SAM) {Human (Homo sapiens) [TaxId: 9606]}
sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkalllltkedfryrs
phsgdelyellqhilkqrdhhhhhh
Timeline for d1ji7c_: