Lineage for d1ji7a_ (1ji7 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1493398Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1493399Family a.60.1.1: Pointed domain [47770] (7 proteins)
  6. 1493409Protein Etv6 transcription factor pointed domain (Tel SAM) [74735] (2 species)
  7. 1493419Species Human (Homo sapiens) [TaxId:9606] [74736] (2 PDB entries)
  8. 1493420Domain d1ji7a_: 1ji7 A: [71682]
    complexed with so4

Details for d1ji7a_

PDB Entry: 1ji7 (more details), 1.45 Å

PDB Description: crystal structure of tel sam polymer
PDB Compounds: (A:) ets-related protein tel1

SCOPe Domain Sequences for d1ji7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji7a_ a.60.1.1 (A:) Etv6 transcription factor pointed domain (Tel SAM) {Human (Homo sapiens) [TaxId: 9606]}
sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkalllltkedfryrs
phsgdelyellqhilkq

SCOPe Domain Coordinates for d1ji7a_:

Click to download the PDB-style file with coordinates for d1ji7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ji7a_: