![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
![]() | Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
![]() | Protein automated matches [190276] (12 species) not a true protein |
![]() | Species Desulfovibrio vulgaris [TaxId:882] [187896] (2 PDB entries) |
![]() | Domain d2j7ag_: 2j7a G: [165931] automated match to d1oaha_ complexed with act, ca, hec, lmt |
PDB Entry: 2j7a (more details), 2.3 Å
SCOPe Domain Sequences for d2j7ag_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j7ag_ a.138.1.3 (G:) automated matches {Desulfovibrio vulgaris [TaxId: 882]} gcsdvstelktpvyktkltaeeirnsafkpefpkqyasyerndettvmteykgsvpfnkn dnvnplpegyrhaqpylknlwlgypfmyeyrearghtyaiqdflhidrinryaekgglpa tcwncktpkmmewvkesgdgfwakdvnefrdkidmkdhtigcatchdpqtmelritsvpl tdylvsqgkdpkklprnemralvcgqchveyyfngptmgvnkkpvfpwaegfdpadmyry ydkhgdlqvkgfegkfadwthpasktpmikaqhpeyetwingthgaagvtcadchmsytr sddkkkisshwwtspmkdpemracrqchsdktpdylksrvlftqkrtfdlllaaqevsvk aheavrlaneyqgakaagyddlmiqaremvrkgqffwdyvsaensvgfhnpakaldtlaq sqqfsqkaidlameatqygigkdlsgdiktivppilkmnrklqqdpefmkthkwfqylpv lpkadqvwdgqkrl
Timeline for d2j7ag_: