Lineage for d2j7aq_ (2j7a Q:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734319Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 2734414Protein automated matches [190276] (12 species)
    not a true protein
  7. 2734420Species Desulfovibrio vulgaris [TaxId:882] [187896] (2 PDB entries)
  8. 2734432Domain d2j7aq_: 2j7a Q: [165938]
    automated match to d1oaha_
    complexed with act, ca, hec, lmt

Details for d2j7aq_

PDB Entry: 2j7a (more details), 2.3 Å

PDB Description: crystal structure of cytochrome c nitrite reductase nrfha complex from desulfovibrio vulgaris
PDB Compounds: (Q:) cytochrome c nitrite reductase nrfa

SCOPe Domain Sequences for d2j7aq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j7aq_ a.138.1.3 (Q:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
gcsdvstelktpvyktkltaeeirnsafkpefpkqyasyerndettvmteykgsvpfnkn
dnvnplpegyrhaqpylknlwlgypfmyeyrearghtyaiqdflhidrinryaekgglpa
tcwncktpkmmewvkesgdgfwakdvnefrdkidmkdhtigcatchdpqtmelritsvpl
tdylvsqgkdpkklprnemralvcgqchveyyfngptmgvnkkpvfpwaegfdpadmyry
ydkhgdlqvkgfegkfadwthpasktpmikaqhpeyetwingthgaagvtcadchmsytr
sddkkkisshwwtspmkdpemracrqchsdktpdylksrvlftqkrtfdlllaaqevsvk
aheavrlaneyqgakaagyddlmiqaremvrkgqffwdyvsaensvgfhnpakaldtlaq
sqqfsqkaidlameatqygigkdlsgdiktivppilkmnrklqqdpefmkthkwfqylpv
lpkadqvwdgqkrlv

SCOPe Domain Coordinates for d2j7aq_:

Click to download the PDB-style file with coordinates for d2j7aq_.
(The format of our PDB-style files is described here.)

Timeline for d2j7aq_: