SCOPe 2.08: Domain d2j7aj

Lineage for d2j7aj_ (2j7a J:)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
variable number of helices and little beta structure; not a true fold
annotated by the SCOP(e) curators as 'not a true fold'
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
duplication: contains multiple CxxCH motifs

Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
the main characteristic feature of this motif is the packing of its two hemes
many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

Protein automated matches [190276] (12 species)
not a true protein
Species Desulfovibrio vulgaris [TaxId:882] [187896] (2 PDB entries)
Domain d2j7aj_: 2j7a J: [165933]
automated match to d1oaha_
complexed with act, ca, hec, lmt

Details for d2j7aj_

PDB Entry: 2j7a (more details), 2.3 Å

PDB Description: crystal structure of cytochrome c nitrite reductase nrfha complex from desulfovibrio vulgaris

PDB Compounds: (J:) cytochrome c nitrite reductase nrfa

SCOPe Domain Sequences for d2j7aj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j7aj_ a.138.1.3 (J:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
gcsdvstelktpvyktkltaeeirnsafkpefpkqyasyerndettvmteykgsvpfnkn
dnvnplpegyrhaqpylknlwlgypfmyeyrearghtyaiqdflhidrinryaekgglpa
tcwncktpkmmewvkesgdgfwakdvnefrdkidmkdhtigcatchdpqtmelritsvpl
tdylvsqgkdpkklprnemralvcgqchveyyfngptmgvnkkpvfpwaegfdpadmyry
ydkhgdlqvkgfegkfadwthpasktpmikaqhpeyetwingthgaagvtcadchmsytr
sddkkkisshwwtspmkdpemracrqchsdktpdylksrvlftqkrtfdlllaaqevsvk
aheavrlaneyqgakaagyddlmiqaremvrkgqffwdyvsaensvgfhnpakaldtlaq
sqqfsqkaidlameatqygigkdlsgdiktivppilkmnrklqqdpefmkthkwfqylpv
lpkadqvwdgqkrl

SCOPe Domain Coordinates for d2j7aj_:

Click to download the PDB-style file with coordinates for d2j7aj_.
(The format of our PDB-style files is described here.)

Timeline for d2j7aj_: