![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
![]() | Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family) ![]() contains irregular N-terminal subdomain automatically mapped to Pfam PF02287 |
![]() | Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (2 proteins) |
![]() | Protein Diol dehydratase, gamma subunit [47150] (2 species) |
![]() | Species Klebsiella oxytoca [TaxId:571] [47151] (8 PDB entries) |
![]() | Domain d1egmg_: 1egm G: [16494] Other proteins in same PDB: d1egma_, d1egmb_, d1egme_, d1egml_ complexed with cnc, k, pgo |
PDB Entry: 1egm (more details), 1.85 Å
SCOPe Domain Sequences for d1egmg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1egmg_ a.23.2.1 (G:) Diol dehydratase, gamma subunit {Klebsiella oxytoca [TaxId: 571]} sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv reaatlyverkklkgdd
Timeline for d1egmg_: