Lineage for d1egml_ (1egm L:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089476Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (4 families) (S)
  5. 2089521Family c.1.19.3: Diol dehydratase, alpha subunit [51710] (2 protein domains)
    automatically mapped to Pfam PF02286
  6. 2089522Protein Diol dehydratase, alpha subunit [51711] (2 species)
  7. 2089523Species Klebsiella oxytoca [TaxId:571] [51712] (7 PDB entries)
  8. 2089533Domain d1egml_: 1egm L: [29655]
    Other proteins in same PDB: d1egmb_, d1egme_, d1egmg_, d1egmm_
    complexed with cnc, k, pgo

Details for d1egml_

PDB Entry: 1egm (more details), 1.85 Å

PDB Description: crystal structure of diol dehydratase-cyanocobalamin complex at 100k.
PDB Compounds: (L:) propanediol dehydratase

SCOPe Domain Sequences for d1egml_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egml_ c.1.19.3 (L:) Diol dehydratase, alpha subunit {Klebsiella oxytoca [TaxId: 571]}
mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
iknipgaldpn

SCOPe Domain Coordinates for d1egml_:

Click to download the PDB-style file with coordinates for d1egml_.
(The format of our PDB-style files is described here.)

Timeline for d1egml_: