Lineage for d1egmg_ (1egm G:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2194Fold a.23: Open three-helical up-and-down bundle [47143] (4 superfamilies)
  4. 2202Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family) (S)
  5. 2203Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (1 protein)
  6. 2204Protein Diol dehydratase, gamma subunit [47150] (1 species)
  7. 2205Species Klebsiella oxytoca [TaxId:571] [47151] (4 PDB entries)
  8. 2210Domain d1egmg_: 1egm G: [16494]
    Other proteins in same PDB: d1egma_, d1egmb_, d1egme_, d1egml_

Details for d1egmg_

PDB Entry: 1egm (more details), 1.85 Å

PDB Description: crystal structure of diol dehydratase-cyanocobalamin complex at 100k.

SCOP Domain Sequences for d1egmg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egmg_ a.23.2.1 (G:) Diol dehydratase, gamma subunit {Klebsiella oxytoca}
sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda
grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv
reaatlyverkklkgdd

SCOP Domain Coordinates for d1egmg_:

Click to download the PDB-style file with coordinates for d1egmg_.
(The format of our PDB-style files is described here.)

Timeline for d1egmg_: