PDB entry 1egm

View 1egm on RCSB PDB site
Description: crystal structure of diol dehydratase-cyanocobalamin complex at 100k.
Class: lyase
Keywords: cyanocobalamin, propanediol, potassium ion, tim barrel, lyase
Deposited on 2000-02-15, released 2000-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.182
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: propanediol dehydratase
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1egma_
  • Chain 'B':
    Compound: propanediol dehydratase
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1egmb_
  • Chain 'E':
    Compound: propanediol dehydratase
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1egme_
  • Chain 'G':
    Compound: propanediol dehydratase
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1egmg_
  • Chain 'L':
    Compound: propanediol dehydratase
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1egml_
  • Chain 'M':
    Compound: propanediol dehydratase
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1egmm_
  • Heterogens: K, CNC, PGO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1egmA (A:)
    mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
    lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
    nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
    fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
    skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
    scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
    ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
    avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
    gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
    iknipgaldpneid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1egmA (A:)
    mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
    lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
    nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
    fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
    skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
    scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
    ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
    avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
    gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
    iknipgaldpn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1egmB (B:)
    meinekllrqiiedvlsemkgsdkpvsfnapaasaapqatppagdgfltevgearqgtqq
    deviiavgpafglaqtvnivgiphksilreviagieeegikarvircfkssdvafvaveg
    nrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltletyrqigknaaryakres
    pqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrval
    

    Sequence, based on observed residues (ATOM records): (download)
    >1egmB (B:)
    gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
    rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
    rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrva
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1egmE (E:)
    meinekllrqiiedvlsemkgsdkpvsfnapaasaapqatppagdgfltevgearqgtqq
    deviiavgpafglaqtvnivgiphksilreviagieeegikarvircfkssdvafvaveg
    nrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltletyrqigknaaryakres
    pqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrval
    

    Sequence, based on observed residues (ATOM records): (download)
    >1egmE (E:)
    gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
    rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
    rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1egmG (G:)
    mntdaiesmvrdvlsrmnslqgeapaaapaaggasrsarvsdyplankhpewvktatnkt
    lddftlenvlsnkvtaqdmritpetlrlqasiakdagrdrlamnferaaeltavpddril
    eiynalrpyrstkeellaiaddlesryqakicaafvreaatlyverkklkgdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1egmG (G:)
    sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda
    grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv
    reaatlyverkklkgdd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1egmL (L:)
    mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
    lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
    nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
    fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
    skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
    scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
    ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
    avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
    gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
    iknipgaldpneid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1egmL (L:)
    mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
    lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
    nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
    fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
    skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
    scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
    ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
    avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
    gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
    iknipgaldpn
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1egmM (M:)
    mntdaiesmvrdvlsrmnslqgeapaaapaaggasrsarvsdyplankhpewvktatnkt
    lddftlenvlsnkvtaqdmritpetlrlqasiakdagrdrlamnferaaeltavpddril
    eiynalrpyrstkeellaiaddlesryqakicaafvreaatlyverkklkgdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1egmM (M:)
    sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda
    grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv
    reaatlyverkklkgdd