Lineage for d1egmb_ (1egm B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2882071Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families) (S)
  5. 2882072Family c.51.3.1: Diol dehydratase, beta subunit [52969] (1 protein)
    contains additional structures in the C-terminal extension
  6. 2882073Protein Diol dehydratase, beta subunit [52970] (2 species)
  7. 2882074Species Klebsiella oxytoca [TaxId:571] [52971] (11 PDB entries)
  8. 2882095Domain d1egmb_: 1egm B: [33217]
    Other proteins in same PDB: d1egma_, d1egmg_, d1egml_, d1egmm_
    complexed with cnc, k, pgo

Details for d1egmb_

PDB Entry: 1egm (more details), 1.85 Å

PDB Description: crystal structure of diol dehydratase-cyanocobalamin complex at 100k.
PDB Compounds: (B:) propanediol dehydratase

SCOPe Domain Sequences for d1egmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egmb_ c.51.3.1 (B:) Diol dehydratase, beta subunit {Klebsiella oxytoca [TaxId: 571]}
gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrva

SCOPe Domain Coordinates for d1egmb_:

Click to download the PDB-style file with coordinates for d1egmb_.
(The format of our PDB-style files is described here.)

Timeline for d1egmb_: