Lineage for d1hq3b_ (1hq3 B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.22: Histone-fold [47112] (1 superfamily) Superfamily a.22.1: Histone-fold [47113] (3 families) 
Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) 
Protein Histone H2B [47119] (2 species) Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47120] (4 PDB entries) 
Domain d1hq3b_: 1hq3 B: [16444]
Other proteins in same PDB: d1hq3a_, d1hq3c_, d1hq3d_, d1hq3e_, d1hq3g_, d1hq3h_
Details for d1hq3b_
PDB Entry: 1hq3 (more details), 2.15 Å
PDB Description: crystal structure of the histone-core-octamer in kcl/phosphate
SCOP Domain Sequences for d1hq3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hq3b_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes}
rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsr
eiqtavrlllpgelakhavsegtkavtkytss
SCOP Domain Coordinates for d1hq3b_:
Click to download the PDB-style file with coordinates for d1hq3b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hq3b_:
- d1hq3b_ appears in SCOP 1.57
- d1hq3b_ appears in the current release, SCOPe 2.08
View in 3D
