Lineage for d1hq3g_ (1hq3 G:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2110Fold a.22: Histone-fold [47112] (1 superfamily)
  4. 2111Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 2112Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
  6. 2140Protein Histone H3 [47122] (2 species)
  7. 2146Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47123] (4 PDB entries)
  8. 2148Domain d1hq3g_: 1hq3 G: [16455]
    Other proteins in same PDB: d1hq3a_, d1hq3b_, d1hq3d_, d1hq3e_, d1hq3f_, d1hq3h_

Details for d1hq3g_

PDB Entry: 1hq3 (more details), 2.15 Å

PDB Description: crystal structure of the histone-core-octamer in kcl/phosphate

SCOP Domain Sequences for d1hq3g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hq3g_ a.22.1.1 (G:) Histone H3 {Chicken (Gallus gallus), erythrocytes}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvglfedtnlcaihakrvtimpkdiqlarrirgera

SCOP Domain Coordinates for d1hq3g_:

Click to download the PDB-style file with coordinates for d1hq3g_.
(The format of our PDB-style files is described here.)

Timeline for d1hq3g_: