Class a: All alpha proteins [46456] (290 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H2B [47119] (6 species) |
Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47120] (6 PDB entries) Uniprot P02279 |
Domain d1hq3b_: 1hq3 B: [16444] Other proteins in same PDB: d1hq3a_, d1hq3c_, d1hq3d_, d1hq3e_, d1hq3g_, d1hq3h_ complexed with cl, po4 |
PDB Entry: 1hq3 (more details), 2.15 Å
SCOPe Domain Sequences for d1hq3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hq3b_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsr eiqtavrlllpgelakhavsegtkavtkytss
Timeline for d1hq3b_: