Lineage for d1hq3b_ (1hq3 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698177Protein Histone H2B [47119] (6 species)
  7. 2698266Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47120] (6 PDB entries)
    Uniprot P02279
  8. 2698271Domain d1hq3b_: 1hq3 B: [16444]
    Other proteins in same PDB: d1hq3a_, d1hq3c_, d1hq3d_, d1hq3e_, d1hq3g_, d1hq3h_
    complexed with cl, po4

Details for d1hq3b_

PDB Entry: 1hq3 (more details), 2.15 Å

PDB Description: crystal structure of the histone-core-octamer in kcl/phosphate
PDB Compounds: (B:) histone h2b

SCOPe Domain Sequences for d1hq3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hq3b_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsr
eiqtavrlllpgelakhavsegtkavtkytss

SCOPe Domain Coordinates for d1hq3b_:

Click to download the PDB-style file with coordinates for d1hq3b_.
(The format of our PDB-style files is described here.)

Timeline for d1hq3b_: