SCOPe 2.08: Domain d1vgmb_: 1vgm B:

Lineage for d1vgmb_ (1vgm B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.103: Citrate synthase [48255] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.103.1: Citrate synthase [48256] (2 families)

5. Family a.103.1.1: Citrate synthase [48257] (2 proteins)
   duplication: large domain consists of two structural repeats
   the second repeat is interrupted by the small domain
   automatically mapped to Pfam PF00285

6. Protein automated matches [190675] (10 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:111955] [188060] (1 PDB entry)

8. Domain d1vgmb_: 1vgm B: [161862]
   automated match to d1o7xc_
   complexed with gol, so4

Details for d1vgmb_

PDB Entry: 1vgm, 2 Å

PDB Description: crystal structure of an isozyme of citrate synthase from sulfolbus tokodaii strain7

PDB Compounds: (B:) 378aa long hypothetical citrate synthase

SCOPe Domain Sequences for d1vgmb_:

Sequence; same for both SEQRES and ATOM records:

>d1vgmb_ a.103.1.1 (B:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
vevsrglenviikttgltyidgingilryrgydindlvnyasyeelihlmlygelpnrqq
lnqikgiinesfevpeqvistifsmprncdaigmmetafgilasiydpkwnratnkelav
qiiaktatitaniyrakeglkpkipepsesyaesflaatfgkkptqeeikamdaslilyt
dhevpasttaalvasstlsdmyscivaalaalkgplhggaaeeafkqfveigsvenadkw
feekiikgksrlmgfghrvyktydprakifktlaksfaeknenvkkyyeiaerieklgvd
tfgskhiypntdfysgivfyalgfpiymftslfalsrvlgwlahiieyveeqhrlirpra
lyigpekrefkpielr

Timeline for d1vgmb_:

• d1vgmb_ first appeared in SCOPe 2.01
  
• d1vgmb_ appears in SCOPe 2.07