Class a: All alpha proteins [46456] (290 folds) |
Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.103.1: Citrate synthase [48256] (2 families) |
Family a.103.1.1: Citrate synthase [48257] (2 proteins) duplication: large domain consists of two structural repeats the second repeat is interrupted by the small domain automatically mapped to Pfam PF00285 |
Protein automated matches [190675] (10 species) not a true protein |
Species Sulfolobus tokodaii [TaxId:111955] [188060] (1 PDB entry) |
Domain d1vgmb_: 1vgm B: [161862] automated match to d1o7xc_ complexed with gol, so4 |
PDB Entry: 1vgm (more details), 2 Å
SCOPe Domain Sequences for d1vgmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vgmb_ a.103.1.1 (B:) automated matches {Sulfolobus tokodaii [TaxId: 111955]} vevsrglenviikttgltyidgingilryrgydindlvnyasyeelihlmlygelpnrqq lnqikgiinesfevpeqvistifsmprncdaigmmetafgilasiydpkwnratnkelav qiiaktatitaniyrakeglkpkipepsesyaesflaatfgkkptqeeikamdaslilyt dhevpasttaalvasstlsdmyscivaalaalkgplhggaaeeafkqfveigsvenadkw feekiikgksrlmgfghrvyktydprakifktlaksfaeknenvkkyyeiaerieklgvd tfgskhiypntdfysgivfyalgfpiymftslfalsrvlgwlahiieyveeqhrlirpra lyigpekrefkpielr
Timeline for d1vgmb_: