Lineage for d1vgma_ (1vgm A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722943Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2722944Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2722945Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2723011Protein automated matches [190675] (10 species)
    not a true protein
  7. 2723038Species Sulfolobus tokodaii [TaxId:111955] [188060] (1 PDB entry)
  8. 2723039Domain d1vgma_: 1vgm A: [161861]
    automated match to d1o7xc_
    complexed with gol, so4

Details for d1vgma_

PDB Entry: 1vgm (more details), 2 Å

PDB Description: crystal structure of an isozyme of citrate synthase from sulfolbus tokodaii strain7
PDB Compounds: (A:) 378aa long hypothetical citrate synthase

SCOPe Domain Sequences for d1vgma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgma_ a.103.1.1 (A:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
vevsrglenviikttgltyidgingilryrgydindlvnyasyeelihlmlygelpnrqq
lnqikgiinesfevpeqvistifsmprncdaigmmetafgilasiydpkwnratnkelav
qiiaktatitaniyrakeglkpkipepsesyaesflaatfgkkptqeeikamdaslilyt
dhevpasttaalvasstlsdmyscivaalaalkgplhggaaeeafkqfveigsvenadkw
feekiikgksrlmgfghrvyktydprakifktlaksfaeknenvkkyyeiaerieklgvd
tfgskhiypntdfysgivfyalgfpiymftslfalsrvlgwlahiieyveeqhrlirpra
lyigpekrefkpielr

SCOPe Domain Coordinates for d1vgma_:

Click to download the PDB-style file with coordinates for d1vgma_.
(The format of our PDB-style files is described here.)

Timeline for d1vgma_: