PDB entry 1vgm

View 1vgm on RCSB PDB site
Description: Crystal Structure of an Isozyme of Citrate Synthase from Sulfolbus tokodaii strain7
Class: transferase
Keywords: Open Form, TRANSFERASE
Deposited on 2004-04-27, released 2005-06-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 378aa long hypothetical citrate synthase
    Species: Sulfolobus tokodaii [TaxId:111955]
    Gene: strain7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vgma_
  • Chain 'B':
    Compound: 378aa long hypothetical citrate synthase
    Species: Sulfolobus tokodaii [TaxId:111955]
    Gene: strain7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vgmb_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vgmA (A:)
    msvevsrglenviikttgltyidgingilryrgydindlvnyasyeelihlmlygelpnr
    qqlnqikgiinesfevpeqvistifsmprncdaigmmetafgilasiydpkwnratnkel
    avqiiaktatitaniyrakeglkpkipepsesyaesflaatfgkkptqeeikamdaslil
    ytdhevpasttaalvasstlsdmyscivaalaalkgplhggaaeeafkqfveigsvenad
    kwfeekiikgksrlmgfghrvyktydprakifktlaksfaeknenvkkyyeiaerieklg
    vdtfgskhiypntdfysgivfyalgfpiymftslfalsrvlgwlahiieyveeqhrlirp
    ralyigpekrefkpielr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgmA (A:)
    vevsrglenviikttgltyidgingilryrgydindlvnyasyeelihlmlygelpnrqq
    lnqikgiinesfevpeqvistifsmprncdaigmmetafgilasiydpkwnratnkelav
    qiiaktatitaniyrakeglkpkipepsesyaesflaatfgkkptqeeikamdaslilyt
    dhevpasttaalvasstlsdmyscivaalaalkgplhggaaeeafkqfveigsvenadkw
    feekiikgksrlmgfghrvyktydprakifktlaksfaeknenvkkyyeiaerieklgvd
    tfgskhiypntdfysgivfyalgfpiymftslfalsrvlgwlahiieyveeqhrlirpra
    lyigpekrefkpielr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vgmB (B:)
    msvevsrglenviikttgltyidgingilryrgydindlvnyasyeelihlmlygelpnr
    qqlnqikgiinesfevpeqvistifsmprncdaigmmetafgilasiydpkwnratnkel
    avqiiaktatitaniyrakeglkpkipepsesyaesflaatfgkkptqeeikamdaslil
    ytdhevpasttaalvasstlsdmyscivaalaalkgplhggaaeeafkqfveigsvenad
    kwfeekiikgksrlmgfghrvyktydprakifktlaksfaeknenvkkyyeiaerieklg
    vdtfgskhiypntdfysgivfyalgfpiymftslfalsrvlgwlahiieyveeqhrlirp
    ralyigpekrefkpielr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgmB (B:)
    vevsrglenviikttgltyidgingilryrgydindlvnyasyeelihlmlygelpnrqq
    lnqikgiinesfevpeqvistifsmprncdaigmmetafgilasiydpkwnratnkelav
    qiiaktatitaniyrakeglkpkipepsesyaesflaatfgkkptqeeikamdaslilyt
    dhevpasttaalvasstlsdmyscivaalaalkgplhggaaeeafkqfveigsvenadkw
    feekiikgksrlmgfghrvyktydprakifktlaksfaeknenvkkyyeiaerieklgvd
    tfgskhiypntdfysgivfyalgfpiymftslfalsrvlgwlahiieyveeqhrlirpra
    lyigpekrefkpielr