Lineage for d1o7xc_ (1o7x C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722943Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2722944Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2722945Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2722946Protein Citrate synthase [48258] (7 species)
  7. 2723000Species Sulfolobus solfataricus [TaxId:2287] [81861] (1 PDB entry)
  8. 2723003Domain d1o7xc_: 1o7x C: [81173]

Details for d1o7xc_

PDB Entry: 1o7x (more details), 2.7 Å

PDB Description: citrate synthase from sulfolobus solfataricus
PDB Compounds: (C:) citrate synthase

SCOPe Domain Sequences for d1o7xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7xc_ a.103.1.1 (C:) Citrate synthase {Sulfolobus solfataricus [TaxId: 2287]}
vvskglenviikvtnltfidgekgilryrgyniedlvnygsyeetiylmlygklptkkel
ndlkaklneeyevpqevldtiylmpkeadaigllevgtaalasidknfkwkendkekais
iiakmatlvanvyrrkegnkpripepsdsfaksfllasfarepttdeinamdkalilytd
hevpasttaalvaastlsdmyssltaalaalkgplhggaaeeafkqfieigdpnrvqnwf
ndkvvnqknrlmgfghrvyktydprakifkklaltliernadarryfeiaqkleelgikq
fsskgiypntdfysgivfyalgfpvymftalfalsrtlgwlahiieyveeqhrlirpral
yvgpeyqeyv

SCOPe Domain Coordinates for d1o7xc_:

Click to download the PDB-style file with coordinates for d1o7xc_.
(The format of our PDB-style files is described here.)

Timeline for d1o7xc_: