![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.8: N-terminal domain of molybdate-dependent transcriptional regulator ModE [46810] (1 protein) contains beta-hairpin in the N-terminal extension and two helices in the C-terminal extension |
![]() | Protein N-terminal domain of molybdate-dependent transcriptional regulator ModE [46811] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [46812] (3 PDB entries) |
![]() | Domain d1b9nb1: 1b9n B:1-126 [16121] Other proteins in same PDB: d1b9na3, d1b9na4, d1b9nb3, d1b9nb4 complexed with ni |
PDB Entry: 1b9n (more details), 2.09 Å
SCOPe Domain Sequences for d1b9nb1:
Sequence, based on SEQRES records: (download)
>d1b9nb1 a.4.5.8 (B:1-126) N-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]} mqaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnqlse hilveratggkggggavltrygqrliqlydllaqiqqkafdvlsdddalplnsllaaisr fslqts
>d1b9nb1 a.4.5.8 (B:1-126) N-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]} mqaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnqlse hilveavltrygqrliqlydllaqiqqkafdvlsdddalplnsllaaisrfslqts
Timeline for d1b9nb1: