Lineage for d1b9nb1 (1b9n B:1-126)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693206Family a.4.5.8: N-terminal domain of molybdate-dependent transcriptional regulator ModE [46810] (1 protein)
    contains beta-hairpin in the N-terminal extension and two helices in the C-terminal extension
  6. 2693207Protein N-terminal domain of molybdate-dependent transcriptional regulator ModE [46811] (1 species)
  7. 2693208Species Escherichia coli [TaxId:562] [46812] (3 PDB entries)
  8. 2693212Domain d1b9nb1: 1b9n B:1-126 [16121]
    Other proteins in same PDB: d1b9na3, d1b9na4, d1b9nb3, d1b9nb4
    complexed with ni

Details for d1b9nb1

PDB Entry: 1b9n (more details), 2.09 Å

PDB Description: regulator from escherichia coli
PDB Compounds: (B:) protein (mode)

SCOPe Domain Sequences for d1b9nb1:

Sequence, based on SEQRES records: (download)

>d1b9nb1 a.4.5.8 (B:1-126) N-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]}
mqaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnqlse
hilveratggkggggavltrygqrliqlydllaqiqqkafdvlsdddalplnsllaaisr
fslqts

Sequence, based on observed residues (ATOM records): (download)

>d1b9nb1 a.4.5.8 (B:1-126) N-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]}
mqaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnqlse
hilveavltrygqrliqlydllaqiqqkafdvlsdddalplnsllaaisrfslqts

SCOPe Domain Coordinates for d1b9nb1:

Click to download the PDB-style file with coordinates for d1b9nb1.
(The format of our PDB-style files is described here.)

Timeline for d1b9nb1: