![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.6: MOP-like [50331] (4 families) ![]() |
![]() | Family b.40.6.2: BiMOP, duplicated molybdate-binding domain [50335] (2 proteins) duplication: tandem repeat of two OB-fold domains with swapped C-terminal strands automatically mapped to Pfam PF03459 |
![]() | Protein C-terminal domain of molybdate-dependent transcriptional regulator ModE [63405] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [50337] (5 PDB entries) |
![]() | Domain d1b9na3: 1b9n A:127-199 [58942] Other proteins in same PDB: d1b9na1, d1b9nb1 complexed with ni |
PDB Entry: 1b9n (more details), 2.09 Å
SCOPe Domain Sequences for d1b9na3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b9na3 b.40.6.2 (A:127-199) C-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]} arnqwfgtitardhddvqqhvdvlladgktrlkvaitaqsgarlgldegkevlillkapw vgitqdeavaqna
Timeline for d1b9na3: