PDB entry 1b9n

View 1b9n on RCSB PDB site
Description: regulator from escherichia coli
Class: transcription
Keywords: DNA-binding, gene regulation, winged helix turn helix, molybdate, ob fold, transcription
Deposited on 1999-02-12, released 2000-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.214
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (mode)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9G8 (3-264)
      • see remark 999 (1-2)
    Domains in SCOPe 2.07: d1b9na1, d1b9na3, d1b9na4
  • Chain 'B':
    Compound: protein (mode)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b9nb1, d1b9nb3, d1b9nb4
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b9nA (A:)
    gshmqaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnq
    lsehilveratggkggggavltrygqrliqlydllaqiqqkafdvlsdddalplnsllaa
    isrfslqtsarnqwfgtitardhddvqqhvdvlladgktrlkvaitaqsgarlgldegke
    vlillkapwvgitqdeavaqnadnqlpgiishiergaeqcevlmalpdgqtlcatvpvne
    atslqqgqnvtayfnadsviiatlc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b9nA (A:)
    shmqaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnql
    sehilveratgavltrygqrliqlydllaqiqqkafdvlsdddalplnsllaaisrfslq
    tsarnqwfgtitardhddvqqhvdvlladgktrlkvaitaqsgarlgldegkevlillka
    pwvgitqdeavaqnadnqlpgiishiergaeqcevlmalpdgqtlcatvpvneatslqqg
    qnvtayfnadsviiatlc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b9nB (B:)
    gshmqaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnq
    lsehilveratggkggggavltrygqrliqlydllaqiqqkafdvlsdddalplnsllaa
    isrfslqtsarnqwfgtitardhddvqqhvdvlladgktrlkvaitaqsgarlgldegke
    vlillkapwvgitqdeavaqnadnqlpgiishiergaeqcevlmalpdgqtlcatvpvne
    atslqqgqnvtayfnadsviiatlc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b9nB (B:)
    mqaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnqlse
    hilveavltrygqrliqlydllaqiqqkafdvlsdddalplnsllaaisrfslqtsarnq
    wfgtitaqhvdvlladgktrlkvaitaqsgarlgldegkevlillkapwvgitqdeavaq
    nadnqlpgiishiergaeqcevlmalpdgqtlcatvpvneatslqqgqnvtayfnadsvi
    iatlc