Lineage for d1b9na1 (1b9n A:-2-126)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982435Family a.4.5.8: N-terminal domain of molybdate-dependent transcriptional regulator ModE [46810] (1 protein)
    contains beta-hairpin in the N-terminal extension and two helices in the C-terminal extension
  6. 1982436Protein N-terminal domain of molybdate-dependent transcriptional regulator ModE [46811] (1 species)
  7. 1982437Species Escherichia coli [TaxId:562] [46812] (3 PDB entries)
  8. 1982440Domain d1b9na1: 1b9n A:-2-126 [16120]
    Other proteins in same PDB: d1b9na3, d1b9na4, d1b9nb3, d1b9nb4
    complexed with ni

Details for d1b9na1

PDB Entry: 1b9n (more details), 2.09 Å

PDB Description: regulator from escherichia coli
PDB Compounds: (A:) protein (mode)

SCOPe Domain Sequences for d1b9na1:

Sequence, based on SEQRES records: (download)

>d1b9na1 a.4.5.8 (A:-2-126) N-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]}
shmqaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnql
sehilveratggkggggavltrygqrliqlydllaqiqqkafdvlsdddalplnsllaai
srfslqts

Sequence, based on observed residues (ATOM records): (download)

>d1b9na1 a.4.5.8 (A:-2-126) N-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]}
shmqaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnql
sehilveratgavltrygqrliqlydllaqiqqkafdvlsdddalplnsllaaisrfslq
ts

SCOPe Domain Coordinates for d1b9na1:

Click to download the PDB-style file with coordinates for d1b9na1.
(The format of our PDB-style files is described here.)

Timeline for d1b9na1: