SCOP 1.63: Domain d1mnmd_: 1mnm D:

Lineage for d1mnmd_ (1mnm D:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (11 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (21 proteins)

6. Protein mat alpha2 Homeodomain [46695] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46696] (6 PDB entries)

8. Domain d1mnmd_: 1mnm D: [15984]
   Other proteins in same PDB: d1mnma_, d1mnmb_
   protein/DNA complex

Details for d1mnmd_

PDB Entry: 1mnm, 2.25 Å

PDB Description: yeast matalpha2/mcm1/dna ternary transcription complex crystal structure

SCOP Domain Sequences for d1mnmd_:

Sequence; same for both SEQRES and ATOM records:

>d1mnmd_ a.4.1.1 (D:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae)}
glvfnvvtqdminkstkpyrghrftkenvrileswfaknienpyldtkglenlmkntsls
riqiknwvsnrrrkekt

Timeline for d1mnmd_:

• d1mnmd_ first appeared (with stable ids) in SCOP 1.55
  
• d1mnmd_ appears in SCOP 1.61
  
• d1mnmd_ appears in SCOP 1.65
  
• d1mnmd_ appears in the current release, SCOPe 2.08