Lineage for d1mnmd_ (1mnm D:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277521Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 277522Superfamily a.4.1: Homeodomain-like [46689] (11 families) (S)
    consists only of helices
  5. 277523Family a.4.1.1: Homeodomain [46690] (21 proteins)
  6. 277569Protein mat alpha2 Homeodomain [46695] (1 species)
  7. 277570Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46696] (6 PDB entries)
  8. 277576Domain d1mnmd_: 1mnm D: [15984]
    Other proteins in same PDB: d1mnma_, d1mnmb_
    protein/DNA complex

Details for d1mnmd_

PDB Entry: 1mnm (more details), 2.25 Å

PDB Description: yeast matalpha2/mcm1/dna ternary transcription complex crystal structure

SCOP Domain Sequences for d1mnmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mnmd_ a.4.1.1 (D:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae)}
glvfnvvtqdminkstkpyrghrftkenvrileswfaknienpyldtkglenlmkntsls
riqiknwvsnrrrkekt

SCOP Domain Coordinates for d1mnmd_:

Click to download the PDB-style file with coordinates for d1mnmd_.
(The format of our PDB-style files is described here.)

Timeline for d1mnmd_: