Lineage for d1mnmb_ (1mnm B:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 259811Fold d.88: SRF-like [55454] (1 superfamily)
    alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet
  4. 259812Superfamily d.88.1: SRF-like [55455] (1 family) (S)
  5. 259813Family d.88.1.1: SRF-like [55456] (3 proteins)
  6. 259814Protein MCM1 transcriptional regulator [55459] (1 species)
  7. 259815Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55460] (1 PDB entry)
  8. 259817Domain d1mnmb_: 1mnm B: [40233]
    Other proteins in same PDB: d1mnmc_, d1mnmd_
    protein/DNA complex

Details for d1mnmb_

PDB Entry: 1mnm (more details), 2.25 Å

PDB Description: yeast matalpha2/mcm1/dna ternary transcription complex crystal structure

SCOP Domain Sequences for d1mnmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mnmb_ d.88.1.1 (B:) MCM1 transcriptional regulator {Baker's yeast (Saccharomyces cerevisiae)}
rrkieikfienktrrhvtfskrkhgimkkafelsvltgtqvlllvvsetglvytfstpkf
epivtqqegrnliqaclnapd

SCOP Domain Coordinates for d1mnmb_:

Click to download the PDB-style file with coordinates for d1mnmb_.
(The format of our PDB-style files is described here.)

Timeline for d1mnmb_: