Lineage for d1du0a_ (1du0 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691791Protein Engrailed Homeodomain [46691] (1 species)
  7. 2691792Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46692] (12 PDB entries)
  8. 2691804Domain d1du0a_: 1du0 A: [15974]
    protein/DNA complex

Details for d1du0a_

PDB Entry: 1du0 (more details), 2 Å

PDB Description: engrailed homeodomain q50a variant dna complex
PDB Compounds: (A:) engrailed homeodomain

SCOPe Domain Sequences for d1du0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1du0a_ a.4.1.1 (A:) Engrailed Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
afsseqlarlkrefnenrylterrrqqlsselglneaqikiwfankrakikks

SCOPe Domain Coordinates for d1du0a_:

Click to download the PDB-style file with coordinates for d1du0a_.
(The format of our PDB-style files is described here.)

Timeline for d1du0a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1du0b_