PDB entry 1du0

View 1du0 on RCSB PDB site
Description: engrailed homeodomain q50a variant DNA complex
Class: transcription/DNA
Keywords: homeodomain, DNA-binding protein, protein-DNA complex, TRANSCRIPTION/DNA COMPLEX
Deposited on 2000-01-13, released 2000-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.234
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: engrailed homeodomain
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02836
      • engineered (47)
    Domains in SCOPe 2.07: d1du0a_
  • Chain 'B':
    Compound: engrailed homeodomain
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02836 (0-End)
      • engineered (47)
    Domains in SCOPe 2.07: d1du0b_
  • Chain 'C':
    Compound: DNA (5'-d(*tp*tp*tp*tp*gp*cp*cp*ap*tp*gp*tp*ap*ap*tp*tp*ap*cp*cp*tp*ap*a)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*ap*tp*tp*ap*gp*gp*tp*ap*ap*tp*tp*ap*cp*ap*tp*gp*gp*cp*ap*ap*a)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1du0A (A:)
    rprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfankrakikks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du0A (A:)
    afsseqlarlkrefnenrylterrrqqlsselglneaqikiwfankrakikks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1du0B (B:)
    rprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfankrakikks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du0B (B:)
    rprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfankrakikk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.