Lineage for d3dllp1 (3dll P:8-134)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555601Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 2555602Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 2555603Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 2555604Protein Ribosomal protein L22 [54845] (5 species)
  7. 2555605Species Deinococcus radiodurans [TaxId:1299] [160265] (6 PDB entries)
    Uniprot Q9RXJ7 8-134
  8. 2555607Domain d3dllp1: 3dll P:8-134 [157793]
    Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
    automatically matched to 2ZJR P:8-134
    complexed with mg, zld, zn

Details for d3dllp1

PDB Entry: 3dll (more details), 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning
PDB Compounds: (P:) 50S ribosomal protein L22

SCOPe Domain Sequences for d3dllp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dllp1 d.55.1.1 (P:8-134) Ribosomal protein L22 {Deinococcus radiodurans [TaxId: 1299]}
frnkkqrkqqvklrkpgfavakyvrmsprkvrlvvdvirgksvqdaedllrfiprsasep
vakvlnsakanalhndemledrlfvkeayvdagptlkrliprargsaniikkrtshitii
vaekgnk

SCOPe Domain Coordinates for d3dllp1:

Click to download the PDB-style file with coordinates for d3dllp1.
(The format of our PDB-style files is described here.)

Timeline for d3dllp1: