Lineage for d3dlld1 (3dll D:3-179)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565168Fold d.77: RL5-like [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 2565169Superfamily d.77.1: RL5-like [55282] (3 families) (S)
  5. 2565170Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 2565171Protein Ribosomal protein L5 [55284] (5 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 2565175Species Deinococcus radiodurans [TaxId:1299] [160487] (6 PDB entries)
    Uniprot Q9RXJ0 3-179
  8. 2565177Domain d3dlld1: 3dll D:3-179 [157781]
    Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
    automatically matched to 2ZJR D:3-179
    complexed with mg, zld, zn

Details for d3dlld1

PDB Entry: 3dll (more details), 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning
PDB Compounds: (D:) 50S ribosomal protein L5

SCOPe Domain Sequences for d3dlld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dlld1 d.77.1.1 (D:3-179) Ribosomal protein L5 {Deinococcus radiodurans [TaxId: 1299]}
qlktkyndqvrpalmqqfgyssvmavpriekivvneglgsskedskaidkaakelalitl
qkpiitkakksisnfklrqgmpvgikvtlrgermyvflekliniglprirdfrginpnaf
dgrgnynlgikeqlifpeitydmvdktrgmditivttaktdeearallqsmglpfrk

SCOPe Domain Coordinates for d3dlld1:

Click to download the PDB-style file with coordinates for d3dlld1.
(The format of our PDB-style files is described here.)

Timeline for d3dlld1: