Class g: Small proteins [56992] (98 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) |
Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein) Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail |
Protein Ribosomal protein L32p [144201] (3 species) |
Species Deinococcus radiodurans [TaxId:1299] [161178] (6 PDB entries) Uniprot P49228 2-59 |
Domain d3dlly1: 3dll Y:2-59 [157801] Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1 automatically matched to 2ZJR Z:2-59 complexed with mg, zld, zn |
PDB Entry: 3dll (more details), 3.5 Å
SCOPe Domain Sequences for d3dlly1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dlly1 g.41.8.5 (Y:2-59) Ribosomal protein L32p {Deinococcus radiodurans [TaxId: 1299]} akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla
Timeline for d3dlly1:
View in 3D Domains from other chains: (mouse over for more information) d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1 |