Lineage for d3dlly1 (3dll Y:2-59)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641696Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 2641848Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein)
    Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail
  6. 2641849Protein Ribosomal protein L32p [144201] (3 species)
  7. 2641850Species Deinococcus radiodurans [TaxId:1299] [161178] (6 PDB entries)
    Uniprot P49228 2-59
  8. 2641852Domain d3dlly1: 3dll Y:2-59 [157801]
    Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1
    automatically matched to 2ZJR Z:2-59
    complexed with mg, zld, zn

Details for d3dlly1

PDB Entry: 3dll (more details), 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning
PDB Compounds: (Y:) 50S ribosomal protein L32

SCOPe Domain Sequences for d3dlly1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dlly1 g.41.8.5 (Y:2-59) Ribosomal protein L32p {Deinococcus radiodurans [TaxId: 1299]}
akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla

SCOPe Domain Coordinates for d3dlly1:

Click to download the PDB-style file with coordinates for d3dlly1.
(The format of our PDB-style files is described here.)

Timeline for d3dlly1: