Lineage for d3dlls1 (3dll S:1-175)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412454Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 2412455Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) (S)
  5. 2412456Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins)
  6. 2412491Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species)
    contains additional all-beta (sub)domain in the C-terminal extension
  7. 2412492Species Deinococcus radiodurans [TaxId:1299] [159200] (6 PDB entries)
    Uniprot Q9RX88 1-175
  8. 2412494Domain d3dlls1: 3dll S:1-175 [157796]
    Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
    automatically matched to 2ZJR S:1-175
    complexed with mg, zld, zn

Details for d3dlls1

PDB Entry: 3dll (more details), 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning
PDB Compounds: (S:) 50S ribosomal protein L25

SCOPe Domain Sequences for d3dlls1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dlls1 b.53.1.1 (S:1-175) Ribosomal protein TL5 (general stress protein CTC) {Deinococcus radiodurans [TaxId: 1299]}
meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlppr

SCOPe Domain Coordinates for d3dlls1:

Click to download the PDB-style file with coordinates for d3dlls1.
(The format of our PDB-style files is described here.)

Timeline for d3dlls1: