Lineage for d3dlln1 (3dll N:2-118)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347885Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 2347926Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) (S)
    automatically mapped to Pfam PF00453
  5. 2347927Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein)
  6. 2347928Protein Ribosomal protein L20 [74733] (4 species)
  7. 2347931Species Deinococcus radiodurans [TaxId:1299] [158512] (6 PDB entries)
    Uniprot Q9RSW7 2-118
  8. 2347933Domain d3dlln1: 3dll N:2-118 [157791]
    Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
    automatically matched to 2ZJR N:2-118
    complexed with mg, zld, zn

Details for d3dlln1

PDB Entry: 3dll (more details), 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning
PDB Compounds: (N:) 50S ribosomal protein L20

SCOPe Domain Sequences for d3dlln1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dlln1 a.144.2.1 (N:2-118) Ribosomal protein L20 {Deinococcus radiodurans [TaxId: 1299]}
praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw
iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq

SCOPe Domain Coordinates for d3dlln1:

Click to download the PDB-style file with coordinates for d3dlln1.
(The format of our PDB-style files is described here.)

Timeline for d3dlln1: