SCOPe 2.05: Domain d3dlli1: 3dll I:4-144

Lineage for d3dlli1 (3dll I:4-144)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
   core: three turns of irregular (beta-beta-alpha)n superhelix

4. Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family)

5. Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)

6. Protein Ribosomal protein L15 (L15p) [52082] (4 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159455] (6 PDB entries)
   Uniprot Q9RSK9 4-144

8. Domain d3dlli1: 3dll I:4-144 [157786]
   Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
   automatically matched to 2ZJR I:4-144
   complexed with mg, zld, zn

Details for d3dlli1

PDB Entry: 3dll, 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning

PDB Compounds: (I:) 50S ribosomal protein L15

SCOPe Domain Sequences for d3dlli1:

Sequence; same for both SEQRES and ATOM records:

>d3dlli1 c.12.1.1 (I:4-144) Ribosomal protein L15 (L15p) {Deinococcus radiodurans [TaxId: 1299]}
hdlkptpgsrkdrkrvgrgpggtdktagrghkgqksrsgagkgaffeggrsrliarlpkr
gfnnvgttyevvklsqlqdledttfdrdtleayrlvrrknrpvkllasgeisravtvhvd
aasaaaikaveaaggrvvlpe

Timeline for d3dlli1:

• d3dlli1 first appeared in SCOP 1.75
  
• d3dlli1 appears in SCOPe 2.04
  
• d3dlli1 appears in SCOPe 2.06
  
• d3dlli1 appears in the current release, SCOPe 2.08