SCOPe 2.05: Domain d3dlld1: 3dll D:3-179

Lineage for d3dlld1 (3dll D:3-179)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.77: RL5-like [55281] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654

4. Superfamily d.77.1: RL5-like [55282] (3 families)

5. Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)

6. Protein Ribosomal protein L5 [55284] (5 species)
   synonym: 50S ribosomal protein L5p, HMAL5, HL13

7. Species Deinococcus radiodurans [TaxId:1299] [160487] (6 PDB entries)
   Uniprot Q9RXJ0 3-179

8. Domain d3dlld1: 3dll D:3-179 [157781]
   Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
   automatically matched to 2ZJR D:3-179
   complexed with mg, zld, zn

Details for d3dlld1

PDB Entry: 3dll, 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning

PDB Compounds: (D:) 50S ribosomal protein L5

SCOPe Domain Sequences for d3dlld1:

Sequence; same for both SEQRES and ATOM records:

>d3dlld1 d.77.1.1 (D:3-179) Ribosomal protein L5 {Deinococcus radiodurans [TaxId: 1299]}
qlktkyndqvrpalmqqfgyssvmavpriekivvneglgsskedskaidkaakelalitl
qkpiitkakksisnfklrqgmpvgikvtlrgermyvflekliniglprirdfrginpnaf
dgrgnynlgikeqlifpeitydmvdktrgmditivttaktdeearallqsmglpfrk

Timeline for d3dlld1:

• d3dlld1 first appeared in SCOP 1.75
  
• d3dlld1 appears in SCOPe 2.04
  
• d3dlld1 appears in SCOPe 2.06
  
• d3dlld1 appears in the current release, SCOPe 2.08