SCOPe 2.05: Domain d3dll31: 3dll 3:2-64

Lineage for d3dll31 (3dll 3:2-64)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.301: L35p-like [143033] (1 superfamily)
   core: alpha-beta(3)-alpha; 2layers a/b

4. Superfamily d.301.1: L35p-like [143034] (1 family)
   automatically mapped to Pfam PF01632

5. Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein)
   Pfam PF01632

6. Protein Ribosomal protein L35p [143036] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [160056] (6 PDB entries)
   Uniprot Q9RSW6 2-64

8. Domain d3dll31: 3dll 3:2-64 [157777]
   Other proteins in same PDB: d3dll11, d3dll21, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
   automatically matched to 2ZJR 3:2-64
   complexed with mg, zld, zn

Details for d3dll31

PDB Entry: 3dll, 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning

PDB Compounds: (3:) 50S ribosomal protein L35

SCOPe Domain Sequences for d3dll31:

Sequence; same for both SEQRES and ATOM records:

>d3dll31 d.301.1.1 (3:2-64) Ribosomal protein L35p {Deinococcus radiodurans [TaxId: 1299]}
pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
lpr

Timeline for d3dll31:

• d3dll31 first appeared in SCOP 1.75
  
• d3dll31 appears in SCOPe 2.04
  
• d3dll31 appears in SCOPe 2.06
  
• d3dll31 appears in the current release, SCOPe 2.08