Lineage for d3dllj1 (3dll J:6-141)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1902857Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 1903099Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 1903164Family d.41.4.2: Ribosomal protein L16p [117888] (1 protein)
    Pfam PF00252
  6. 1903165Protein Ribosomal protein L16p [117889] (4 species)
  7. 1903166Species Deinococcus radiodurans [TaxId:1299] [160196] (6 PDB entries)
    Uniprot Q9RXJ5 5-140
  8. 1903172Domain d3dllj1: 3dll J:6-141 [157787]
    Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
    automatically matched to 2ZJR J:6-141
    complexed with mg, zld, zn

Details for d3dllj1

PDB Entry: 3dll (more details), 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning
PDB Compounds: (J:) 50S ribosomal protein L16

SCOPe Domain Sequences for d3dllj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dllj1 d.41.4.2 (J:6-141) Ribosomal protein L16p {Deinococcus radiodurans [TaxId: 1299]}
krtkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrrggki
yirifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrlaghk
lpiqtkmvkrevydea

SCOPe Domain Coordinates for d3dllj1:

Click to download the PDB-style file with coordinates for d3dllj1.
(The format of our PDB-style files is described here.)

Timeline for d3dllj1: