SCOPe 2.05: Domain d3dlln1: 3dll N:2-118

Lineage for d3dlln1 (3dll N:2-118)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.144: PABP domain-like [63569] (2 superfamilies)
   4 helices; an orthogonal array

4. Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family)
   automatically mapped to Pfam PF00453

5. Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein)

6. Protein Ribosomal protein L20 [74733] (4 species)

7. Species Deinococcus radiodurans [TaxId:1299] [158512] (6 PDB entries)
   Uniprot Q9RSW7 2-118

8. Domain d3dlln1: 3dll N:2-118 [157791]
   Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dlle1, d3dlle2, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1
   automatically matched to 2ZJR N:2-118
   complexed with mg, zld, zn

Details for d3dlln1

PDB Entry: 3dll, 3.5 Å

PDB Description: the oxazolidinone antibiotics perturb the ribosomal peptidyl- transferase center and effect trna positioning

PDB Compounds: (N:) 50S ribosomal protein L20

SCOPe Domain Sequences for d3dlln1:

Sequence; same for both SEQRES and ATOM records:

>d3dlln1 a.144.2.1 (N:2-118) Ribosomal protein L20 {Deinococcus radiodurans [TaxId: 1299]}
praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw
iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq

Timeline for d3dlln1:

• d3dlln1 first appeared in SCOP 1.75
  
• d3dlln1 appears in SCOPe 2.04
  
• d3dlln1 appears in SCOPe 2.06
  
• d3dlln1 appears in the current release, SCOPe 2.08