Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) consists of two beta-sheets and one alpha-helix packed around single core |
Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) automatically mapped to Pfam PF00347 |
Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
Protein Ribosomal protein L6 [56055] (6 species) duplication: consists of two domains of this fold |
Species Deinococcus radiodurans [TaxId:1299] [160798] (6 PDB entries) Uniprot Q9RSL3 8-82! Uniprot Q9RSL3 83-172 |
Domain d3dlle1: 3dll E:83-172 [157782] Other proteins in same PDB: d3dll11, d3dll21, d3dll31, d3dll41, d3dllb1, d3dllc1, d3dlld1, d3dllg1, d3dllh1, d3dlli1, d3dllj1, d3dllk1, d3dlll1, d3dllm1, d3dlln1, d3dllo1, d3dllp1, d3dllq1, d3dllr1, d3dlls1, d3dllt1, d3dllu1, d3dllv1, d3dllw1, d3dlly1 automatically matched to 2ZJR E:83-172 complexed with mg, zld, zn |
PDB Entry: 3dll (more details), 3.5 Å
SCOPe Domain Sequences for d3dlle1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dlle1 d.141.1.1 (E:83-172) Ribosomal protein L6 {Deinococcus radiodurans [TaxId: 1299]} ytinlelrgvgfrakltgkalemnigyshpviieppagvtfavpeptridvsgidkqlvg qvaanvrkvrkpdayhgkgvrfvgeqialk
Timeline for d3dlle1: