Lineage for d3df3m1 (3df3 M:1-113)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735301Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 2735302Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 2735303Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
    automatically mapped to Pfam PF00416
  6. 2735304Protein Ribosomal protein S13 [46948] (2 species)
  7. 2735305Species Escherichia coli [TaxId:562] [158360] (26 PDB entries)
    Uniprot P0A7S9 1-114
  8. 2735314Domain d3df3m1: 3df3 M:1-113 [157669]
    Other proteins in same PDB: d3df3b1, d3df3c1, d3df3c2, d3df3d1, d3df3e1, d3df3e2, d3df3f1, d3df3g1, d3df3h1, d3df3i1, d3df3j1, d3df3k1, d3df3l1, d3df3n1, d3df3o1, d3df3p1, d3df3q1, d3df3r1, d3df3s1, d3df3t1, d3df3u1
    protein/RNA complex; complexed with hyg, mg
    protein/RNA complex; complexed with hyg, mg

Details for d3df3m1

PDB Entry: 3df3 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the second 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (M:) 30S ribosomal protein S13

SCOPe Domain Sequences for d3df3m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df3m1 a.156.1.1 (M:1-113) Ribosomal protein S13 {Escherichia coli [TaxId: 562]}
ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprk

SCOPe Domain Coordinates for d3df3m1:

Click to download the PDB-style file with coordinates for d3df3m1.
(The format of our PDB-style files is described here.)

Timeline for d3df3m1: