SCOPe 2.08: Domain d3df3n1: 3df3 N:1-100

Lineage for d3df3n1 (3df3 N:1-100)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (2 species)

7. Species Escherichia coli [TaxId:562] [161162] (24 PDB entries)
   Uniprot P02370 1-100

8. Domain d3df3n1: 3df3 N:1-100 [157670]
   Other proteins in same PDB: d3df3b1, d3df3c1, d3df3c2, d3df3d1, d3df3e1, d3df3e2, d3df3f1, d3df3g1, d3df3h1, d3df3i1, d3df3j1, d3df3k1, d3df3l1, d3df3m1, d3df3o1, d3df3p1, d3df3q1, d3df3r1, d3df3s1, d3df3t1, d3df3u1
   protein/RNA complex; complexed with hyg, mg
   protein/RNA complex; complexed with hyg, mg
   has additional insertions and/or extensions that are not grouped together

Details for d3df3n1

PDB Entry: 3df3, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the second 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d3df3n1:

Sequence, based on SEQRES records:

>d3df3n1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]}
akqsmkarevkrvaladkyfakraelkaiisdvnasdedrwnavlklqtlprdsspsrqr
nrcrqtgrphgflrkfglsrikvreaamrgeipglkkasw

Sequence, based on observed residues (ATOM records):

>d3df3n1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]}
akqsmkarevkrvaladkyfakraelkaiisdvnarwnavlklqtlprdsspsrqrnrcr
qtgrphgflrkfglsrikvreaamrgeipglkkasw

Timeline for d3df3n1:

• d3df3n1 first appeared in SCOP 1.75
  
• d3df3n1 appears in SCOPe 2.07