| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) ![]() automatically mapped to Pfam PF01649 |
| Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein) this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain |
| Protein Ribosomal protein S20 [46994] (2 species) |
| Species Escherichia coli [TaxId:562] [158365] (26 PDB entries) Uniprot P0A7U7 2-86 |
| Domain d3df3t1: 3df3 T:2-86 [157676] Other proteins in same PDB: d3df3b1, d3df3c1, d3df3c2, d3df3d1, d3df3e1, d3df3e2, d3df3f1, d3df3g1, d3df3h1, d3df3i1, d3df3j1, d3df3k1, d3df3l1, d3df3m1, d3df3n1, d3df3o1, d3df3p1, d3df3q1, d3df3r1, d3df3s1, d3df3u1 protein/RNA complex; complexed with hyg, mg protein/RNA complex; complexed with hyg, mg |
PDB Entry: 3df3 (more details), 3.5 Å
SCOPe Domain Sequences for d3df3t1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3df3t1 a.7.6.1 (T:2-86) Ribosomal protein S20 {Escherichia coli [TaxId: 562]}
niksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqa
akglihknkaarhkanltaqinkla
Timeline for d3df3t1: