| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123 |
Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) ![]() automatically mapped to Pfam PF00203 |
| Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
| Protein Ribosomal protein S19 [54572] (2 species) |
| Species Escherichia coli [TaxId:562] [160144] (26 PDB entries) Uniprot P0A7U3 2-80 |
| Domain d3df3s1: 3df3 S:2-80 [157675] Other proteins in same PDB: d3df3b1, d3df3c1, d3df3c2, d3df3d1, d3df3e1, d3df3e2, d3df3f1, d3df3g1, d3df3h1, d3df3i1, d3df3j1, d3df3k1, d3df3l1, d3df3m1, d3df3n1, d3df3o1, d3df3p1, d3df3q1, d3df3r1, d3df3t1, d3df3u1 protein/RNA complex; complexed with hyg, mg protein/RNA complex; complexed with hyg, mg |
PDB Entry: 3df3 (more details), 3.5 Å
SCOPe Domain Sequences for d3df3s1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3df3s1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]}
rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv
tdemvghklgefaptrtyr
Timeline for d3df3s1: