Lineage for d3df3k1 (3df3 K:12-128)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2887539Superfamily c.55.4: Translational machinery components [53137] (3 families) (S)
  5. 2887540Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 2887630Protein Ribosomal protein S11 [53141] (2 species)
  7. 2887631Species Escherichia coli [TaxId:562] [159644] (24 PDB entries)
    Uniprot P0A7R9 12-128
  8. 2887640Domain d3df3k1: 3df3 K:12-128 [157667]
    Other proteins in same PDB: d3df3b1, d3df3c1, d3df3c2, d3df3d1, d3df3e1, d3df3e2, d3df3f1, d3df3g1, d3df3h1, d3df3i1, d3df3j1, d3df3l1, d3df3m1, d3df3n1, d3df3o1, d3df3p1, d3df3q1, d3df3r1, d3df3s1, d3df3t1, d3df3u1
    protein/RNA complex; complexed with hyg, mg
    protein/RNA complex; complexed with hyg, mg

Details for d3df3k1

PDB Entry: 3df3 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the second 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (K:) 30S ribosomal protein S11

SCOPe Domain Sequences for d3df3k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df3k1 c.55.4.1 (K:12-128) Ribosomal protein S11 {Escherichia coli [TaxId: 562]}
rkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpfaaqvaaercad
avkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngcrppkkrrv

SCOPe Domain Coordinates for d3df3k1:

Click to download the PDB-style file with coordinates for d3df3k1.
(The format of our PDB-style files is described here.)

Timeline for d3df3k1: