SCOPe 2.08: Domain d3cd621: 3cd6 2:1-49

Lineage for d3cd621 (3cd6 2:1-49)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family)
   interrupted alpha-helix
   automatically mapped to Pfam PF00832

5. Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)

6. Protein Ribosomal protein L39e [48664] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
   Uniprot P22452

8. Domain d3cd621: 3cd6 2:1-49 [156477]
   Other proteins in same PDB: d3cd611, d3cd631, d3cd6b1, d3cd6d1, d3cd6f1, d3cd6h1, d3cd6i1, d3cd6j1, d3cd6k1, d3cd6l1, d3cd6n1, d3cd6o1, d3cd6p1, d3cd6q1, d3cd6r1, d3cd6s1, d3cd6t1, d3cd6u1, d3cd6v1, d3cd6w1, d3cd6x1, d3cd6y1, d3cd6z1
   automatically matched to 1VQ4 2:1-49
   complexed with cd, cl, k, mg, na, sr; mutant

Details for d3cd621

PDB Entry: 3cd6, 2.75 Å

PDB Description: co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin

PDB Compounds: (2:) 50S ribosomal protein L39e

SCOPe Domain Sequences for d3cd621:

Sequence, based on SEQRES records:

>d3cd621 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records):

>d3cd621 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde

Timeline for d3cd621:

• d3cd621 first appeared in SCOP 1.75
  
• d3cd621 appears in SCOPe 2.07