Lineage for d3cd621 (3cd6 2:1-49)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778337Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 778338Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
  5. 778339Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 778340Protein Ribosomal protein L39e [48664] (1 species)
  7. 778341Species Archaeon Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
    Uniprot P22452
  8. 778372Domain d3cd621: 3cd6 2:1-49 [156477]
    Other proteins in same PDB: d3cd611, d3cd631, d3cd6b1, d3cd6d1, d3cd6f1, d3cd6h1, d3cd6i1, d3cd6j1, d3cd6k1, d3cd6l1, d3cd6n1, d3cd6o1, d3cd6p1, d3cd6q1, d3cd6r1, d3cd6s1, d3cd6t1, d3cd6u1, d3cd6v1, d3cd6w1, d3cd6x1, d3cd6y1, d3cd6z1
    automatically matched to 1VQ4 2:1-49
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, ur3; mutant

Details for d3cd621

PDB Entry: 3cd6 (more details), 2.75 Å

PDB Description: co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
PDB Compounds: (2:) 50S ribosomal protein L39e

SCOP Domain Sequences for d3cd621:

Sequence, based on SEQRES records: (download)

>d3cd621 a.137.1.1 (2:1-49) Ribosomal protein L39e {Archaeon Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d3cd621 a.137.1.1 (2:1-49) Ribosomal protein L39e {Archaeon Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde

SCOP Domain Coordinates for d3cd621:

Click to download the PDB-style file with coordinates for d3cd621.
(The format of our PDB-style files is described here.)

Timeline for d3cd621: