| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.2: Large subunit [58124] (3 proteins) |
| Protein Prokaryotic (50S subunit) [58125] (3 species) |
| Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
| Domain d3cd631: 3cd6 3:1-92 [156478] Other proteins in same PDB: d3cd621, d3cd6b1, d3cd6f1, d3cd6h1, d3cd6i1, d3cd6p1, d3cd6r1, d3cd6s1, d3cd6y1, d3cd6z1 automatically matched to d1w2b2_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3cd6 (more details), 2.75 Å
SCOPe Domain Sequences for d3cd631:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cd631 i.1.1.2 (3:1-92) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe
Timeline for d3cd631: