Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.55: Ribosomal protein L22 [54842] (1 superfamily) beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation |
Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) some topological similarity to prokaryotic ribosomal protein L17 |
Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein) |
Protein Ribosomal protein L22 [54845] (5 species) |
Species Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries) Uniprot P10970 |
Domain d3cd6r1: 3cd6 R:1-150 [156491] Other proteins in same PDB: d3cd611, d3cd621, d3cd631, d3cd6b1, d3cd6d1, d3cd6f1, d3cd6h1, d3cd6i1, d3cd6j1, d3cd6k1, d3cd6l1, d3cd6n1, d3cd6o1, d3cd6p1, d3cd6q1, d3cd6s1, d3cd6t1, d3cd6u1, d3cd6v1, d3cd6w1, d3cd6x1, d3cd6y1, d3cd6z1 automatically matched to d1ffko_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3cd6 (more details), 2.75 Å
SCOPe Domain Sequences for d3cd6r1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cd6r1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Haloarcula marismortui [TaxId: 2238]} gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg eqqgrkpramgrasawnspqvdvelileep
Timeline for d3cd6r1: