SCOP 1.75: Domain d3cd6r1: 3cd6 R:1-150

Lineage for d3cd6r1 (3cd6 R:1-150)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
   beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation

4. Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family)
   some topological similarity to prokaryotic ribosomal protein L17

5. Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)

6. Protein Ribosomal protein L22 [54845] (5 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries)
   Uniprot P10970

8. Domain d3cd6r1: 3cd6 R:1-150 [156491]
   Other proteins in same PDB: d3cd611, d3cd621, d3cd631, d3cd6b1, d3cd6d1, d3cd6f1, d3cd6h1, d3cd6i1, d3cd6j1, d3cd6k1, d3cd6l1, d3cd6n1, d3cd6o1, d3cd6p1, d3cd6q1, d3cd6s1, d3cd6t1, d3cd6u1, d3cd6v1, d3cd6w1, d3cd6x1, d3cd6y1, d3cd6z1
   automatically matched to d1ffko_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, ur3; mutant

Details for d3cd6r1

PDB Entry: 3cd6, 2.75 Å

PDB Description: co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin

PDB Compounds: (R:) 50S ribosomal protein L22P

SCOP Domain Sequences for d3cd6r1:

Sequence; same for both SEQRES and ATOM records:

>d3cd6r1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Archaeon Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

Timeline for d3cd6r1:

• d3cd6r1 is new in SCOP 1.75
  
• d3cd6r1 appears in SCOPe 2.01
  
• d3cd6r1 appears in the current release, SCOPe 2.08