Class a: All alpha proteins [46456] (290 folds) |
Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily) multihelical; consists of two different 3-helical domains connected by a long, partly helical linker |
Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) automatically mapped to Pfam PF01280 |
Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein) |
Protein Ribosomal protein L19 (L19e) [48142] (1 species) |
Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries) Uniprot P14119 |
Domain d3cd6p1: 3cd6 P:1-143 [156489] Other proteins in same PDB: d3cd611, d3cd621, d3cd631, d3cd6b1, d3cd6d1, d3cd6f1, d3cd6h1, d3cd6i1, d3cd6j1, d3cd6k1, d3cd6l1, d3cd6n1, d3cd6o1, d3cd6q1, d3cd6r1, d3cd6s1, d3cd6t1, d3cd6u1, d3cd6v1, d3cd6w1, d3cd6x1, d3cd6y1, d3cd6z1 automatically matched to d1s72p_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3cd6 (more details), 2.75 Å
SCOPe Domain Sequences for d3cd6p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cd6p1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]} tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr dlydkagggefdsvadleryida
Timeline for d3cd6p1: