Lineage for d3ccvi1 (3ccv I:66-129)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695423Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 2695424Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 2695425Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 2695473Species Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries)
    Uniprot P14122 67-136
  8. 2695504Domain d3ccvi1: 3ccv I:66-129 [156459]
    Other proteins in same PDB: d3ccv11, d3ccv21, d3ccv31, d3ccvb1, d3ccvd1, d3ccvf1, d3ccvh1, d3ccvj1, d3ccvk1, d3ccvl1, d3ccvn1, d3ccvo1, d3ccvp1, d3ccvq1, d3ccvr1, d3ccvs1, d3ccvt1, d3ccvu1, d3ccvv1, d3ccvw1, d3ccvx1, d3ccvy1, d3ccvz1
    automatically matched to d1s72i_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccvi1

PDB Entry: 3ccv (more details), 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
PDB Compounds: (I:) 50S ribosomal protein L11P

SCOPe Domain Sequences for d3ccvi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccvi1 a.4.7.1 (I:66-129) Ribosomal protein L11, C-terminal domain {Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tcts

SCOPe Domain Coordinates for d3ccvi1:

Click to download the PDB-style file with coordinates for d3ccvi1.
(The format of our PDB-style files is described here.)

Timeline for d3ccvi1: